For questions or suggestions e-mail us at: ioerger@cs.tamu.edu
LLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRVGPGASEAPLA
Operon Prediction Model: Genebank
Paralogs
species | id | gene | e-value | identity (len) | annotation |
M. bovis AF2122 / 97 | Mb0032 | - | - | 100% (70) | putative remnant of a transposase |
M. bovis AF2122 / 97 | Mb3002c | - | 6e-10 | 72.22% (36) | resolvase |
M. bovis AF2122 / 97 | Mb2814c | - | 1e-09 | 72.22% (36) | transposase |
Closest Orthologs (e-value cutoff: 1e-4)
species | id | gene | e-value | identity (len) | annotation |
M. gilvum PYR-GCK | - | - | - | - | - |
M. tuberculosis H37Rv | Rv0031 | - | 2e-37 | 100.00% (70) | remnant of A transposase |
M. leprae Br4923 | - | - | - | - | - |
M. abscessus ATCC 19977 | - | - | - | - | - |
M. marinum M | - | - | - | - | - |
M. avium 104 | - | - | - | - | - |
M. smegmatis MC2 155 | - | - | - | - | - |
M. thermoresistible (build 8) | - | - | - | - | - |
M. ulcerans Agy99 | - | - | - | - | - |
M. vanbaalenii PYR-1 | - | - | - | - | - |
CLUSTAL 2.0.9 multiple sequence alignment Mb0032|M.bovis_AF2122/97 MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHT Rv0031|M.tuberculosis_H37Rv MLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHT ************************************************** Mb0032|M.bovis_AF2122/97 SHPSTRKSRVGPGASEAPLA Rv0031|M.tuberculosis_H37Rv SHPSTRKSRVGPGASEAPLA ********************